SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000483299 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000483299
Domain Number 1 Region: 122-286
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.15e-44
Family Matrix metalloproteases, catalytic domain 0.0000522
Further Details:      
 
Domain Number 2 Region: 321-389
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.62e-19
Family Hemopexin-like domain 0.0045
Further Details:      
 
Domain Number 3 Region: 30-96
Classification Level Classification E-value
Superfamily PGBD-like 5.02e-16
Family MMP N-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000483299   Gene: ENSG00000271447   Transcript: ENST00000615136
Sequence length 393
Comment pep:putative chromosome:GRCh38:17:35766340:35795624:-1 gene:ENSG00000271447 transcript:ENST00000615136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVARVGLLLRALQLLLWGHLDAQPAERGGQELRKEAEAFLEKYGYLNEQVPKAPTSTRFS
DAIRAFQWVSQLPVSGVLDRATLRQMTRPRCGVTDTNSYAAWAERISDLFARHRTKMRRK
KRFAKQGNKWYKQHLSYRLVNWPEHLPEPAVRGAVRAAFQLWSNVSALEFWEAPATGPAD
IRLTFFQGDHNDGLGNAFDGPGGALAHAFLPRRGEAHFDQDERWSLSRRRGRNLFVVLAH
EIGHTLGLTHSPAPRALMAPYYKRLGRDALLSWDDVLAVQSLYGKPLGGSVAVQLPGKLF
TDFETWDSYSPQGRRPETQGPKYCHSSFDAITVDRQQQLYIFKGSHFWEVAADGNVSEPR
PLQERWVGLPPNIEAAAVSLNDGDFYFFKVQSV
Download sequence
Identical sequences C0H5X0
ENSP00000479124 ENSP00000483299 NP_116568.1.87134 NP_116568.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]