SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000483349 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000483349
Domain Number 1 Region: 291-481
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.44e-59
Family Hemopexin-like domain 0.0000287
Further Details:      
 
Domain Number 2 Region: 76-257
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.74e-54
Family Matrix metalloproteases, catalytic domain 0.0000000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000483349   Gene: ENSG00000275365   Transcript: ENST00000612388
Sequence length 488
Comment pep:known chromosome:GRCh38:CHR_HSCHR22_1_CTG7:23772849:23784315:1 gene:ENSG00000275365 transcript:ENST00000612388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAAWLRSAAARALLPPMLLLLLQPPPLLARALPPDAHHLHAERRGPQPWHAALPSSPA
PAPATQEAPRPASSLRPPRCGVPDPSDGLSARNRQKRFVLSGGRWEKTDLTYRILRFPWQ
LVQEQVRQTMAEALKVWSDVTPLTFTEVHEGRADIMIDFARYWHGDDLPFDGPGGILAHA
FFPKTHREGDVHFDYDETWTIGDDQGTDLLQVAAHEFGHVLGLQHTTAAKALMSAFYTFR
YPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTNEIAPLEPDAPPDACEASFDA
VSTIRGELFFFKAGFVWRLRGGQLQPGYPALASRHWQGLPSPVDAAFEDAQGHIWFFQGA
QYWVYDGEKPVLGPAPLTELGLVRFPVHAALVWGPEKNKIYFFRGRDYWRFHPSTRRVDS
PVPRRATDWRGVPSEIDAAFQDADGYAYFLRGRLYWKFDPVKVKALEGFPRLVGPDFFGC
AEPANTFL
Download sequence
Identical sequences P24347
9606.ENSP00000215743 ENSP00000215743 ENSP00000215743 ENSP00000483349 ENSP00000215743 NP_005931.2.87134 NP_005931.2.92137 gi|58331148|ref|NP_005931.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]