SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000483705 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000483705
Domain Number 1 Region: 18-196
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.06e-73
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000116
Further Details:      
 
Domain Number 2 Region: 191-323
Classification Level Classification E-value
Superfamily E set domains 2.8e-51
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000483705   Gene: ENSG00000173039   Transcript: ENST00000612991
Sequence length 448
Comment pep:known chromosome:GRCh38:11:65653599:65662972:-1 gene:ENSG00000173039 transcript:ENST00000612991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY
DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQRPPDPAPAPLGAPGL
PNGLLSGDEDFSSIADMDFSALLSQISS
Download sequence
Identical sequences A0A087X0W8 G3R829
ENSP00000483705 NP_001230914.1.87134 NP_001230914.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]