SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000484130 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000484130
Domain Number 1 Region: 207-283
Classification Level Classification E-value
Superfamily GAS2 domain-like 9.42e-27
Family GAS2 domain 0.00019
Further Details:      
 
Domain Number 2 Region: 21-170
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.16e-26
Family Calponin-homology domain, CH-domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000484130   Gene: ENSG00000185340   Transcript: ENST00000610653
Sequence length 337
Comment pep:known chromosome:GRCh38:22:29307041:29312094:1 gene:ENSG00000185340 transcript:ENST00000610653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPVAGIAGSAAKSVRPFRSSEAYVEAMKEDLAEWLNALYGLGLPGGGDGFLTGLATGT
TLCQHANAVTEAARALAAARPARGVAFQAHSVVPGSFMARDNVATFIGWCRVELGVPEVL
MFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIERELRAAPPAPNAPAA
GEDTTETAPAPGTPARGPRMTPSDLRNLDELVREILGRCTCPDQFPMIKVSEGKYRVGDS
SLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCSSTAHRPPQPRVCTFSPQRVSPTT
SPRPASPVPGSERRGSRPEMTPVSLRSTKEGPETPPR
Download sequence
Identical sequences K7ASV1
gi|23065529|ref|NP_689423.1| 9606.ENSP00000344012 ENSP00000484130 ENSP00000344012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]