SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000484202 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000484202
Domain Number - Region: 1-40
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0144
Family Methyl-CpG-binding domain, MBD 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000484202   Gene: ENSG00000071655   Transcript: ENST00000585967
Sequence length 147
Comment pep:putative chromosome:GRCh38:19:1581159:1592359:-1 gene:ENSG00000071655 transcript:ENST00000585967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKIT
NHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDET
LLSAIASALHTSTMPITGQLSAAVEKN
Download sequence
Identical sequences A0A087X1H1 A0A2J8J1W5 A0A2J8R9H6
ENSP00000484202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]