SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000484306 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000484306
Domain Number 1 Region: 4-100
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.37e-19
Family GDI-like N domain 0.00000929
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000484306   Gene: ENSG00000188419   Transcript: ENST00000615443
Sequence length 110
Comment pep:known chromosome:GRCh38:X:85969087:86047539:-1 gene:ENSG00000188419 transcript:ENST00000615443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADTLPSEFDVIVIGTGLPESIIAAACSRSGRRVLHVDSRSYYGGNWASFSFSGLLSWLK
EYQENSDIVSDSPVWQDQILENEEAIALSRKDKTIQHVEVFCYARSTLLL
Download sequence
Identical sequences A0A2I2YIZ1
ENSP00000362228 gi|224028271|ref|NP_001138886.1| NP_001138886.1.87134 NP_001138886.1.92137 ENSP00000484306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]