SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000484330 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000484330
Domain Number 1 Region: 81-311
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.65e-49
Family YicI N-terminal domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 312-477
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.51e-25
Family YicI catalytic domain-like 0.012
Further Details:      
 
Domain Number 3 Region: 40-94
Classification Level Classification E-value
Superfamily Trefoil 0.0000000000209
Family Trefoil 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000484330   Gene: ENSG00000278563   Transcript: ENST00000622623
Sequence length 482
Comment pep:known chromosome:GRCh38:CHR_HSCHR7_2_CTG6:142111754:142143931:1 gene:ENSG00000278563 transcript:ENST00000622623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKLSVLEVLLIIFCLIVVTIDILLLLLVLEETSDTSFTPECPEIPQSERIDCTPDQEV
TEDICRWQYKCCWSPVADANVPRCFFPWNWGYEASNGHTNTSTGFTAQLKRLPSPSLFGN
DVATTLFTAEYQTSNRFHFKITDFNNIRYEVSHENINLVDGIADASNLSYYVEVTDKPFS
IKIMRTSNRRVLLDTSIGPLQFAQQYLQLSFRLPSANVYGLGEHVHQQYRHNMTWKTWPI
FTRDATPTEGMINLYGAHTFFLCLEDARGSSFGVFLMNSNAMEVTLQPAPAITYRTIGGI
LDFYVFLGNTPEQVVQEYLELVGRPFFPPYWSLGFQLSRRDYGGINKLKEVVSRNRLAEI
PYDVQYSDIDYMDGKKDFTVDEVAYSGLPDFVKELHDNGQKYLIIMNPGISKNSNYEPYN
NGSLKRVWILGSNGFAVGEGYPGPTVFPDYTNPVCTEWWTDQVAKFHDHLEFDGVWIVSY
YS
Download sequence
Identical sequences ENSP00000447431 ENSP00000484330 ENSP00000447431 ENSP00000459923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]