SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000484470 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000484470
Domain Number 1 Region: 69-183
Classification Level Classification E-value
Superfamily DNA-binding domain 2.98e-33
Family Methyl-CpG-binding domain, MBD 0.000000724
Further Details:      
 
Weak hits

Sequence:  ENSP00000484470
Domain Number - Region: 196-243
Classification Level Classification E-value
Superfamily E set domains 0.0111
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000484470   Gene: ENSG00000169057   Transcript: ENST00000622433
Sequence length 324
Comment pep:known chromosome:GRCh38:X:154030839:154092293:-1 gene:ENSG00000169057 transcript:ENST00000622433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAET
SEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYL
INPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGT
GRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGATTSTQ
VMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKEFYPICAGDRTPHQE
AQDPGDGQHRGQGSGEAPAGVHPR
Download sequence
Identical sequences A0A087X1U4
ENSP00000484470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]