SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000484899 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000484899
Domain Number 1 Region: 425-595
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000727
Further Details:      
 
Domain Number 2 Region: 81-150,208-242
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-20
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 3 Region: 285-391
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000145
Family Synaptotagmin-like (S variant) 0.031
Further Details:      
 
Domain Number 4 Region: 16-67
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000000000000393
Family DBL homology domain (DH-domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000484899   Gene: ENSG00000276016   Transcript: ENST00000620170
Sequence length 641
Comment pep:known chromosome:GRCh38:CHR_HSCHR17_3_CTG2:1003518:1079916:-1 gene:ENSG00000276016 transcript:ENST00000620170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEILLIIRFCCNCTYALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFL
SSINEDIDPRRTAVTTPKGETRQLVKDGFLVEVSESSRKLRHVFLFTDVLLCAKLKKTSA
GKHQQYDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKMKISALKSEIQKEKANK
GQSRAIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQ
KKDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQ
SANLYCTLEVDSFGYFVSKAKTRVFRDTAEPKWDEEFEIELEGSQSLRILCYEKCYDKTK
VNKDNNEIVDKIMGKGQIQLDPQTVETKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTPS
KKQTGVFGVKISVVTKRERSKVPYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVF
DANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMM
HLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTS
AADIWSHDVMAQVQVLLYYLQHPPISFAELKRNTLYFSTDV
Download sequence
Identical sequences A0A2I2Y3U0 A0A2J8JKH6 A0A2J8SNN6 B7Z683
ENSP00000437429 ENSP00000480343 ENSP00000484899 NP_001269078.1.87134 NP_001269078.1.92137 XP_008968184.1.60992 ENSP00000437429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]