SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000485021 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000485021
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 3.15e-45
Family Eukaryotic RPB5 N-terminal domain 0.00027
Further Details:      
 
Domain Number 2 Region: 135-209
Classification Level Classification E-value
Superfamily RPB5-like RNA polymerase subunit 2.49e-30
Family RPB5 0.0000881
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000485021   Gene: ENSG00000099817   Transcript: ENST00000612655
Sequence length 210
Comment pep:known chromosome:GRCh38:19:1087645:1095380:-1 gene:ENSG00000099817 transcript:ENST00000612655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ
Download sequence
Identical sequences E5KT65 P19388
ENSP00000464739 ENSP00000478303 ENSP00000485021 ENSP00000215587 5iy6_E 5iy7_E 5iy8_E 5iy9_E 5iya_E 5iyb_E 5iyc_E 5iyd_E ENSP00000215587 ENSP00000464739 9606.ENSP00000215587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]