SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000167825 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000167825
Domain Number 1 Region: 1-64
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000000000000314
Family DBL homology domain (DH-domain) 0.0021
Further Details:      
 
Domain Number 2 Region: 361-590
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000677
Family WD40-repeat 0.036
Further Details:      
 
Domain Number 3 Region: 77-155,249-307
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000119
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000167825   Gene: ENSG00000074964   Transcript: ENST00000167825
Sequence length 611
Comment pep:known chromosome:GRCh38:1:17626007:17697868:1 gene:ENSG00000074964 transcript:ENST00000167825 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
KPIQRFPQFILLLQDMLKNTPRGHPDRLSLQLALTELETLAEKLNEQKRLADQVAEIQQL
TKSVSDRSSLNKLLTSGQRQLLLCETLTETVYGDRGQLIKSKERRVFLLNDMLVCANINF
KGQLEISSLVPLGPKYVVKWNTALPQVQVVEVGQDGGTYDKDNVLIQHSGAKKASASGQA
QNKVYLGPPRLFQELQDLQKDLAVVEQITLLISTLHGTYQNLNMTVAQDWCLALQRLMRV
KEEEIHSANKCRLRLLLPGKPDKSGRPISFMVVFITPNPLSKISWVNRLHLAKIGLREEN
QPGWLCPDEDKKSKAPFWCPILACCIPAFSSRALSLQLGALVHSPVNCPLLGFSAVSTSL
PQGYLWVGGGQEGAGGQVEIFSLNRPSPRTVKSFPLAAPVLCMEYIPELEEEAESRDESP
TVADPSATVHPTICLGLQDGSILLYSSVDTGTQCLVSCRSPGLQPVLCLRHSPFHLLAGL
QDGTLAAYPRTSGGVLWDLESPPVCLTVGPGPVRTLLSLEDAVWASCGPRVTVLEATTLQ
PQQSFEAHQDEAVSVTHMVKAGSGVWMAFSSGTSIRLFHTETLEHLQEINIATRTTFLLP
DRSLIKCSPRA
Download sequence
Identical sequences ENSP00000167825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]