SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000217939 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000217939
Domain Number 1 Region: 26-231
Classification Level Classification E-value
Superfamily L domain-like 6.38e-42
Family Ngr ectodomain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 1852-1945
Classification Level Classification E-value
Superfamily Immunoglobulin 1.05e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 2356-2440
Classification Level Classification E-value
Superfamily Immunoglobulin 5.1e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 1948-2047
Classification Level Classification E-value
Superfamily Immunoglobulin 5.45e-20
Family I set domains 0.038
Further Details:      
 
Domain Number 5 Region: 2045-2139
Classification Level Classification E-value
Superfamily Immunoglobulin 5.27e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 6 Region: 2731-2827
Classification Level Classification E-value
Superfamily Immunoglobulin 4.04e-18
Family I set domains 0.02
Further Details:      
 
Domain Number 7 Region: 2540-2633
Classification Level Classification E-value
Superfamily Immunoglobulin 4.63e-18
Family I set domains 0.036
Further Details:      
 
Domain Number 8 Region: 2147-2242
Classification Level Classification E-value
Superfamily Immunoglobulin 7.76e-17
Family I set domains 0.029
Further Details:      
 
Domain Number 9 Region: 590-668
Classification Level Classification E-value
Superfamily Immunoglobulin 8.72e-16
Family I set domains 0.019
Further Details:      
 
Domain Number 10 Region: 2251-2347
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000199
Family I set domains 0.059
Further Details:      
 
Domain Number 11 Region: 487-575
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000113
Family V set domains (antibody variable domain-like) 0.019
Further Details:      
 
Domain Number 12 Region: 2456-2535
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000246
Family V set domains (antibody variable domain-like) 0.077
Further Details:      
 
Domain Number 13 Region: 2646-2732
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000875
Family I set domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000217939   Gene: ENSG00000101825   Transcript: ENST00000217939
Sequence length 2828
Comment pep:known chromosome:GRCh38:X:3308565:3346641:-1 gene:ENSG00000101825 transcript:ENST00000217939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKRAHWGALSVVLILLWGHPRVALACPHPCACYVPSEVHCTFRSLASVPAGIAKHVERI
NLGFNSIQALSETSFAGLTKLELLMIHGNEIPSIPDGALRDLSSLQVFKFSYNKLRVITG
QTLQGLSNLMRLHIDHNKIEFIHPQAFNGLTSLRLLHLEGNLLHQLHPSTFSTFTFLDYF
RLSTIRHLYLAENMVRTLPASMLRNMPLLENLYLQGNPWTCDCEMRWFLEWDAKSRGILK
CKKDKAYEGGQLCAMCFSPKKLYKHEIHKLKDMTCLKPSIESPLRQNRSRSIEEEQEQEE
DGGSQLILEKFQLPQWSISLNMTDEHGNMVNLVCDIKKPMDVYKIHLNQTDPPDIDINAT
VALDFECPMTRENYEKLWKLIAYYSEVPVKLHRELMLSKDPRVSYQYRQDADEEALYYTG
VRAQILAEPEWVMQPSIDIQLNRRQSTAKKVLLSYYTQYSQTISTKDTRQARGRSWVMIE
PSGAVQRDQTVLEGGPCQLSCNVKASESPSIFWVLPDGSILKAPMDDPDSKFSILSSGWL
RIKSMEPSDSGLYQCIAQVRDEMDRMVYRVLVQSPSTQPAEKDTVTIGKNPGESVTLPCN
ALAIPEAHLSWILPNRRIINDLANTSHVYMLPNGTLSIPKVQVSDSGYYRCVAVNQQGAD
HFTVGITVTKKGSGLPSKRGRRPGAKALSRVREDIVEDEGGSGMGDEENTSRRLLHPKDQ
EVFLKTKDDAINGDKKAKKGRRKLKLWKHSEKEPETNVAEGRRVFESRRRINMANKQINP
ERWADILAKVRGKNLPKGTEVPPLIKTTSPPSLSLEVTPPFPAISPPSASPVQTVTSAEE
SSADVPLLGEEEHVLGTISSASMGLEHNHNGVILVEPEVTSTPLEEVVDDLSEKTEEITS
TEGDLKGTAAPTLISEPYEPSPTLHTLDTVYEKPTHEETATEGWSAADVGSSPEPTSSEY
EPPLDAVSLAESEPMQYFDPDLETKSQPDEDKMKEDTFAHLTPTPTIWVNDSSTSQLFED
STIGEPGVPGQSHLQGLTDNIHLVKSSLSTQDTLLIKKGMKEMSQTLQGGNMLEGDPTHS
RSSESEGQESKSITLPDSTLGIMSSMSPVKKPAETTVGTLLDKDTTTATTTPRQKVAPSS
TMSTHPSRRRPNGRRRLRPNKFRHRHKQTPPTTFAPSETFSTQPTQAPDIKISSQVESSL
VPTAWVDNTVNTPKQLEMEKNAEPTSKGTPRRKHGKRPNKHRYTPSTVSSRASGSKPSPS
PENKHRNIVTPSSETILLPRTVSLKTEGPYDSLDYMTTTRKIYSSYPKVQETLPVTYKPT
SDGKEIKDDVATNVDKHKSDILVTGESITNAIPTSRSLVSTMGEFKEESSPVGFPGTPTW
NPSRTAQPGRLQTGIPVTTSGENLTDPPLLKELEDVDFTSEFLSSLTVSTPFHQEEAGSS
TTLSSIKVEVASSQAETTTLDQDHLETTVAILLSETRPQNHTPTAARMKEPASSSPSTIL
MSLGQTTTTKPALPSPRISQASRDSKENVFLNYVGNPETEATPVNNEGTQHMSGPNELST
PSSDQDAFNLSTKLELEKQVFGSRSLPRGPDSQRQDGRVHASHQLTRVPAKPILPTATVR
LPEMSTQSASRYFVTSQSPRHWTNKPEITTYPSGALPENKQFTTPRLSSTTIPLPLHMSK
PSIPSKFTDRRTDQFNGYSKVFGNNNIPEARNPVGKPPSPRIPHYSNGRLPFFTNKTLSF
PQLGVTRRPQIPTSPAPVMRERKVIPGSYNRIHSHSTFHLDFGPPAPPLLHTPQTTGSPS
TNLQNIPMVSSTQSSISFITSSVQSSGSFHQSSSKFFAGGPPASKFWSLGEKPQILTKSP
QTVSVTAETDTVFPCEATGKPKPFVTWTKVSTGALMTPNTRIQRFEVLKNGTLVIRKVQV
QDRGQYMCTASNLHGLDRMVVLLSVTVQQPQILASHYQDVTVYLGDTIAMECLAKGTPAP
QISWIFPDRRVWQTVSPVEGRITLHENRTLSIKEASFSDRGVYKCVASNAAGADSLAIRL
HVAALPPVIHQEKLENISLPPGLSIHIHCTAKAAPLPSVRWVLGDGTQIRPSQFLHGNLF
VFPNGTLYIRNLAPKDSGRYECVAANLVGSARRTVQLNVQRAAANARITGTSPRRTDVRY
GGTLKLDCSASGDPWPRILWRLPSKRMIDALFSFDSRIKVFANGTLVVKSVTDKDAGDYL
CVARNKVGDDYVVLKVDVVMKPAKIEHKEENDHKVFYGGDLKVDCVATGLPNPEISWSLP
DGSLVNSFMQSDDSGGRTKRYVVFNNGTLYFNEVGMREEGDYTCFAENQVGKDEMRVRVK
VVTAPATIRNKTYLAVQVPYGDVVTVACEAKGEPMPKVTWLSPTNKVIPTSSEKYQIYQD
GTLLIQKAQRSDSGNYTCLVRNSAGEDRKTVWIHVNVQPPKINGNPNPITTVREIAAGGS
RKLIDCKAEGIPTPRVLWAFPEGVVLPAPYYGNRITVHGNGSLDIRSLRKSDSVQLVCMA
RNEGGEARLILQLTVLEPMEKPIFHDPISEKITAMAGHTISLNCSAAGTPTPSLVWVLPN
GTDLQSGQQLQRFYHKADGMLHISGLSSVDAGAYRCVARNAAGHTERLVSLKVGLKPEAN
KQYHNLVSIINGETLKLPCTPPGAGQGRFSWTLPNGMHLEGPQTLGRVSLLDNGTLTVRE
ASVFDRGTYVCRMETEYGPSVTSIPVIVIAYPPRITSEPTPVIYTRPGNTVKLNCMAMGI
PKADITWELPDKSHLKAGVQARLYGNRFLHPQGSLTIQHATQRDAGFYKCMAKNILGSDS
KTTYIHVF
Download sequence
Identical sequences Q9NR99
9606.ENSP00000217939 gi|139948432|ref|NP_056234.2| ENSP00000217939 ENSP00000217939 NP_056234.2.87134 NP_056234.2.92137 ENSP00000217939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]