SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000218432 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000218432
Domain Number 1 Region: 62-104
Classification Level Classification E-value
Superfamily FKBP-like 0.0000000399
Family FKBP immunophilin/proline isomerase 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000218432   Gene: ENSG00000102309   Transcript: ENST00000218432
Sequence length 111
Comment pep:putative chromosome:GRCh38:X:72181676:72198337:1 gene:ENSG00000102309 transcript:ENST00000218432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGG
NAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGVCCSYYL
Download sequence
Identical sequences J3KMW3
ENSP00000218432 ENSP00000218432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]