SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000234115 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000234115
Domain Number 1 Region: 3-105
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-22
Family Pleckstrin-homology domain (PH domain) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000234115   Gene: ENSG00000115762   Transcript: ENST00000234115
Sequence length 221
Comment pep:known chromosome:GRCh38:2:131104944:131149852:1 gene:ENSG00000115762 transcript:ENST00000234115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQ
ECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAVMT
DETSVVSSPPPYTAYAAPAPEAYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYG
QQPANQVIIRERYRDNDSDLALGMLAGAATGMALGSLFWVF
Download sequence
Identical sequences NP_060428.2.87134 NP_060428.2.92137 gi|154800476|ref|NP_060428.2| ENSP00000234115 ENSP00000234115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]