SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000245206 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000245206
Domain Number 1 Region: 31-429
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.27e-126
Family AAT-like 0.00000000000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000245206   Gene: ENSG00000125166   Transcript: ENST00000245206
Sequence length 430
Comment pep:known chromosome:GRCh38:16:58707131:58734357:-1 gene:ENSG00000125166 transcript:ENST00000245206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLHSGRVLPGIAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKM
NLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEV
LKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYR
YYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFA
FFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADE
AKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVS
NLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGY
LAHAIHQVTK
Download sequence
Identical sequences P00505
ENSP00000245206 NP_002071.2.87134 NP_002071.2.92137 ENSP00000245206 ENSP00000245206 gi|73486658|ref|NP_002071.2| 9606.ENSP00000245206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]