SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000258530 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000258530
Domain Number 1 Region: 6-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.36e-61
Family BAR domain 0.000000255
Further Details:      
 
Domain Number 2 Region: 278-373
Classification Level Classification E-value
Superfamily PH domain-like 1.46e-23
Family Pleckstrin-homology domain (PH domain) 0.0000132
Further Details:      
 
Domain Number 3 Region: 472-613
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-21
Family Phosphotyrosine-binding domain (PTB) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000258530   Gene: ENSG00000136044   Transcript: ENST00000258530
Sequence length 664
Comment pep:known chromosome:GRCh38:12:105173296:105236238:-1 gene:ENSG00000136044 transcript:ENST00000258530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVDKLLLEEALQDSPQTRSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQ
LSKQLLAYEKQNFALGKGDEEVISTLHYFSKVVDELNLLHTELAKQLADTMVLPIIQFRE
KDLTEVSTLKDLFGLASNEHDLSMAKYSRLPKKKENEKVKTEVGKEVAAARRKQHLSSLQ
YYCALNALQYRKQMAMMEPMIGFAHGQINFFKKGAEMFSKRMDSFLSSVADMVQSIQVEL
EAEAEKMRVSQQELLSVDESVYTPDSDVAAPQINRNLIQKAGYLNLRNKTGLVTTTWERL
YFFTQGGNLMCQPRGAVAGGLIQDLDNCSVMAVDCEDRRYCFQITTPNGKSGIILQAESR
KENEEWICAINNISRQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKQESSCPSQNLKNS
EMENENDKIVPKATASLPEAEELIAPGTPIQFDIVLPATEFLDQNRGSRRTNPFGETEDE
SFPEAEDSLLQQMFIVRFLGSMAVKTDSTTEVIYEAMRQVLAARAIHNIFRMTESHLMVT
SQSLRLIDPQTQVSRANFELTSVTQFAAHQENKRLVGFVIRVPESTGEESLSTYIFESNS
EGEKICYAINLGKEIIEVQKDPEALAQLMLSIPLTNDGKYVLLNDQPDDDDGNPNEHRGA
ESEA
Download sequence
Identical sequences Q8NEU8
ENSP00000258530 9606.ENSP00000258530 gi|24586663|ref|NP_060641.2| NP_060641.2.87134 NP_060641.2.92137 XP_004053848.2.27298 ENSP00000258530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]