SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000259406 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000259406
Domain Number 1 Region: 1062-1192
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.31e-45
Family Regulator of G-protein signaling, RGS 0.00000618
Further Details:      
 
Domain Number 2 Region: 135-261
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.53e-22
Family Synaptotagmin-like (S variant) 0.0012
Further Details:      
 
Domain Number 3 Region: 294-374
Classification Level Classification E-value
Superfamily PDZ domain-like 4.39e-17
Family PDZ domain 0.0000166
Further Details:      
 
Domain Number 4 Region: 552-655
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000812
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000259406   Gene: ENSG00000138835   Transcript: ENST00000350696
Sequence length 1198
Comment pep:known chromosome:GRCh38:9:113460257:113597743:1 gene:ENSG00000138835 transcript:ENST00000350696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVIPALWEVEMGRSQGQEIETILANRSHSDSTPLPNFLSGSHRPECCTCRLLTASGAQD
SLPFGRRLYSGPWRSCEEVCHVSVLSVLSTSCGLSLSLPIFPGWMEWLSPDIALPRRDEW
TQTSPARKRITHAKVQGAGQLRLSIDAQDRVLLLHIIEGKGLISKQPGTCDPYVKISLIP
EDSRLRHQKTQTVPDCRDPAFHEHFFFPVQEEDDQKRLLVTVWNRASQSRQSGLIGCMSF
GVKSLLTPDKEISGWYYLLGEHLGRTKHLKVARRRLRPLRDPLLRMPGGGDTENGKKLKI
TIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHE
IRSCPSEIILLVWRMVPQVKPGPDGGVLRRASCKSTHDLQSPPNKREKNCTHGVQARPEQ
RHSCHLVCDSSDGLLLGGWERYTEVAKRGGQHTLPALSRATAPTDPNYIILAPLNPGSQL
LRPVYQEDTIPEESGSPSKGKSYTGLGKKSRLMKTVQTMKGHGNYQNCPVVRPHATHSSY
GTYVTLAPKVLVFPVFVQPLDLCNPARTLLLSEELLLYEGRNKAAEVTLFAYSDLLLFTK
EDEPGRCDVLRNPLYLQSVKLQEGSSEDLKFCVLYLAEKAECLFTLEAHSQEQKKRVCWC
LSENIAKQQQLAASPPDSKMFETEADEKREMALEEGKGPGAEDSPPSKEPSPGQELPPGQ
DLPPNKDSPSGQEPAPSQEPLSSKDSATSEGSPPGPDAPPSKDVPPCQEPPPAQDLSPCQ
DLPAGQEPLPHQDPLLTKDLPAIQESPTRDLPPCQDLPPSQVSLPAKALTEDTMSSGDLL
AATGDPPAAPRPAFVIPEVRLDSTYSQKAGAEQGCSGDEEDAEEAEEVEEGEEGEEDEDE
DTSDDNYGERSEAKRSSMIETGQGAEGGLSLRVQNSLRRRTHSEGSLLQEPRGPCFASDT
TLHCSDGEGAASTWGMPSPSTLKKELGRNGGSMHHLSLFFTGHRKMSGADTVGDDDEASR
KRKSKNLAKDMKNKLGIFRRRNESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVH
KYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNL
DSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
Download sequence
Identical sequences P49796
ENSP00000259406 gi|114155127|ref|NP_652759.3| 9606.ENSP00000259406 NP_652759.3.87134 NP_652759.3.92137 HR4630 ENSP00000259406 ENSP00000363255 ENSP00000259406 ENSP00000363255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]