SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000260508 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000260508
Domain Number 1 Region: 40-449
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.13e-99
Family AAT-like 0.00000000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000260508   Gene: ENSG00000137944   Transcript: ENST00000260508
Sequence length 454
Comment pep:known chromosome:GRCh38:1:88935816:88992921:-1 gene:ENSG00000137944 transcript:ENST00000260508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLA
ADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQK
QIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRS
KPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYD
TLCISDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIK
HLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESV
GLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSET
KSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS
Download sequence
Identical sequences B4DW13 Q6YP21
NP_001008661.1.87134 NP_001008661.1.92137 gi|56713254|ref|NP_001008661.1| ENSP00000359516 ENSP00000260508 9606.ENSP00000260508 ENSP00000260508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]