SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000265605 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000265605
Domain Number 1 Region: 7-486
Classification Level Classification E-value
Superfamily ALDH-like 3.53e-161
Family ALDH-like 0.000000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000265605   Gene: ENSG00000118514   Transcript: ENST00000265605
Sequence length 487
Comment pep:known chromosome:GRCh38:6:134917390:134950122:-1 gene:ENSG00000118514 transcript:ENST00000265605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTNALLMLENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPS
WSSRSPQERSRVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMDIPRSVQNFRFFASS
SLHHTSECTQMDHLGCMHYTVRAPVGVAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKPS
ELTSVTAWMLCKLLDKAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAIIFEDANLDECIPATVRSSFANQGEICLCTSRIFVQKSIY
SEFLKRFVEATRKWKVGIPSDPLVSIGALISKAHLEKVRSYVKRALAEGAQIWCGEGVDK
LSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLA
ATVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEI
KTITVKH
Download sequence
Identical sequences Q9H2A2
NP_072090.1.87134 NP_072090.1.92137 ENSP00000265605 ENSP00000265605 9606.ENSP00000265605 gi|12007648|ref|NP_072090.1| ENSP00000265605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]