SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000273261 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000273261
Domain Number 1 Region: 114-479
Classification Level Classification E-value
Superfamily L domain-like 4.42e-64
Family Internalin LRR domain 0.06
Further Details:      
 
Domain Number 2 Region: 686-781
Classification Level Classification E-value
Superfamily Immunoglobulin 8.76e-25
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 599-697
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 494-601
Classification Level Classification E-value
Superfamily Immunoglobulin 9.95e-19
Family I set domains 0.019
Further Details:      
 
Domain Number 5 Region: 43-130
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000156
Family Ngr ectodomain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000273261   Gene: ENSG00000144749   Transcript: ENST00000273261
Sequence length 1093
Comment pep:known chromosome:GRCh38:3:66378797:66500932:-1 gene:ENSG00000144749 transcript:ENST00000273261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPVRGGLGAPRRSPCLLLLWLLLLRLEPVTAAAGPRAPCAAACTCAGDSLDCGGRGLA
ALPGDLPSWTRSLNLSYNKLSEIDPAGFEDLPNLQEVYLNNNELTAVPSLGAASSHVVSL
FLQHNKIRSVEGSQLKAYLSLEVLDLSLNNITEVRNTCFPHGPPIKELNLAGNRIGTLEL
GAFDGLSRSLLTLRLSKNRITQLPVRAFKLPRLTQLDLNRNRIRLIEGLTFQGLNSLEVL
KLQRNNISKLTDGAFWGLSKMHVLHLEYNSLVEVNSGSLYGLTALHQLHLSNNSIARIHR
KGWSFCQKLHELVLSFNNLTRLDEESLAELSSLSVLRLSHNSISHIAEGAFKGLRSLRVL
DLDHNEISGTIEDTSGAFSGLDSLSKLTLFGNKIKSVAKRAFSGLEGLEHLNLGGNAIRS
VQFDAFVKMKNLKELHISSDSFLCDCQLKWLPPWLIGRMLQAFVTATCAHPESLKGQSIF
SVPPESFVCDDFLKPQIITQPETTMAMVGKDIRFTCSAASSSSSPMTFAWKKDNEVLTNA
DMENFVHVHAQDGEVMEYTTILHLRQVTFGHEGRYQCVITNHFGSTYSHKARLTVNVLPS
FTKTPHDITIRTTTMARLECAATGHPNPQIAWQKDGGTDFPAARERRMHVMPDDDVFFIT
DVKIDDAGVYSCTAQNSAGSISANATLTVLETPSLVVPLEDRVVSVGETVALQCKATGNP
PPRITWFKGDRPLSLTERHHLTPDNQLLVVQNVVAEDAGRYTCEMSNTLGTERAHSQLSV
LPAAGCRKDGTTVGIFTIAVVSSIVLTSLVWVCIIYQTRKKSEEYSVTNTDETVVPPDVP
SYLSSQGTLSDRQETVVRTEGGPQANGHIESNGVCPRDASHFPEPDTHSVACRQPKLCAG
SAYHKEPWKAMEKAEGTPGPHKMEHGGRVVCSDCNTEVDCYSRGQAFHPQPVSRDSAQPS
APNGPEPGGSDQEHSPHHQCSRTAAGSCPECQGSLYPSNHDRMLTAVKKKPMASLDGKGD
SSWTLARLYHPDSTELQPASSLTSGSPERAEAQYLLVSNGHLPKACDASPESTPLTGQLP
GKQRVPLLLAPKS
Download sequence
Identical sequences Q96JA1
gi|54607118|ref|NP_056356.2| ENSP00000273261 NP_056356.2.87134 NP_056356.2.92137 9606.ENSP00000273261 NYSGRC-IgSF-LRIG1_HUMAN ENSP00000273261 ENSP00000273261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]