SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000286485 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000286485
Domain Number 1 Region: 39-205
Classification Level Classification E-value
Superfamily Sec7 domain 6.41e-58
Family Sec7 domain 0.0000512
Further Details:      
 
Domain Number 2 Region: 251-386
Classification Level Classification E-value
Superfamily PH domain-like 6.43e-29
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000286485   Gene: ENSG00000156011   Transcript: ENST00000286485
Sequence length 513
Comment pep:known chromosome:GRCh38:8:18530710:18808876:-1 gene:ENSG00000156011 transcript:ENST00000286485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSWCLYGCCNAGVKTTRLEAHSEMGSTEILEKETPENLSNGTSSNVEAAKRLAKRLYQ
LDRFKRSDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQERER
VLIHFSNRYFYCNPDTIASQDGVHCLTCAIMLLNTDLHGHNIGKKMTCQEFIANLQGVNE
GVDFSKDLLKALYNSIKNEKLEWAVDDEEKKKSPSESTEEKANGTHPKTISRIGSTTNPF
LDIPHDPNAAVYKSGFLARKIHADMDGKKTPRGKRGWKTFYAVLKGTVLYLQKDEYKPEK
ALSEEDLKNAVSVHHALASKATDYEKKPNVFKLKTADWRVLLFQTQSPEEMQGWINKINC
VAAVFSAPPFPAAIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELAEHRSYPP
DKKVKAKDVDEYKLKDHYLEFEKTRYEMYVSILKEGGKELLSNDESEAAGLKKSHSSPSL
NPDTSPITAKVKRNVSERKDHRPETPSIKQKVT
Download sequence
Identical sequences A0A2J8X445
NP_996792.1.87134 NP_996792.1.92137 gi|45827716|ref|NP_996792.1| ENSP00000286485 ENSP00000286485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]