SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000290765 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000290765
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.36e-38
Family Glutathione S-transferase (GST), N-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 81-236
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.59e-36
Family Glutathione S-transferase (GST), C-terminal domain 0.00000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000290765   Gene: ENSG00000133433   Transcript: ENST00000290765
Sequence length 244
Comment pep:known chromosome:GRCh38:22:23957414:23961186:-1 gene:ENSG00000133433 transcript:ENST00000290765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDG
DFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLG
PLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALG
YELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRI
ARIP
Download sequence
Identical sequences G9J6Q5 P0CG30
gi|124249394|ref|NP_001074312.1| gi|4504187|ref|NP_000845.1| 400226 1ljr_A 1ljr_B 2ljr_A 2ljr_B 3ljr_A 3ljr_B ENSP00000290765 ENSP00000290765 1ljrA 9606.ENSP00000290765 ENSP00000290765 ENSP00000478389 NP_001074312.1.87134 NP_001074312.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]