SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000296486 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000296486
Domain Number 1 Region: 28-433
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.11e-114
Family GABA-aminotransferase-like 0.00000723
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000296486   Gene: ENSG00000164089   Transcript: ENST00000296486
Sequence length 499
Comment pep:known chromosome:GRCh38:4:108742040:108763053:-1 gene:ENSG00000164089 transcript:ENST00000296486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCELYSKRDTLGLRKKHIGPSCKVFFASDPIKIVRAQRQYMFDENGEQYLDCINNVAHVG
HCHPGVVKAALKQMELLNTNSRFLHDNIVEYAKRLSATLPEKLSVCYFTNSGSEANDLAL
RLARQFRGHQDVITLDHAYHGHLSSLIEISPYKFQKGKDVKKEFVHVAPTPDTYRGKYRE
DHADSASAYADEVKKIIEDAHNSGRKIAAFIAESMQSCGGQIIPPAGYFQKVAEYVHGAG
GVFIADEVQVGFGRVGKHFWSFQMYGEDFVPDIVTMGKPMGNGHPVACVVTTKEIAEAFS
SSGMEYFNTYGGNPVSCAVGLAVLDIIENEDLQGNAKRVGNYLTELLKKQKAKHTLIGDI
RGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSADGPHRNVLKIKPPMCFTEE
DAKFMVDQLDRILTVLEEAMGTKTESVTSENTPCKTKMLKEAHIELLRDSTTDSKENPSR
KRNGMCTDTHSLLSKRLKT
Download sequence
Identical sequences Q8TBG4
gi|37574042|ref|NP_112569.2| NP_112569.2.87134 NP_112569.2.92137 9606.ENSP00000296486 ENSP00000296486 ENSP00000296486 ENSP00000296486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]