SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000298190 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000298190
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-26
Family KRAB domain (Kruppel-associated box) 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000298190   Gene: ENSG00000147121   Transcript: ENST00000298190
Sequence length 166
Comment pep:known chromosome:GRCh38:X:46447292:46473669:1 gene:ENSG00000147121 transcript:ENST00000298190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMSQESLTFKDVFVDFTLEEWQQLDSAQKNLYRDVMLENYSHLVSVGYLVAKPDVIFRL
GPGEESWMADGGTPVRTCAEVWQVDEQIDHYKESQDKLPWQAAFIGKETLKDESGQESRT
CRKSIYLSTEFDSVRQRLPKYYSWEKAFKTSFKLSWSKWKLCKKER
Download sequence
Identical sequences ENSP00000298190 gi|194018555|ref|NP_060246.2| NP_060246.2.87134 NP_060246.2.92137 ENSP00000298190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]