SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000302227 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000302227
Domain Number 1 Region: 9-413
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.09e-181
Family AAT-like 0.0000000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000302227   Gene: ENSG00000171097   Transcript: ENST00000302586
Sequence length 422
Comment pep:known chromosome:GRCh38:9:128833113:128882053:-1 gene:ENSG00000171097 transcript:ENST00000302586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFML
NQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVII
IEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVL
NTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTL
TIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFR
QPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDE
PYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKV
EL
Download sequence
Identical sequences A8K563 Q16773
gi|169881279|ref|NP_001116143.1| gi|95147551|ref|NP_004050.3| 3fvs_A 3fvs_B 3fvu_A 3fvu_B 3fvx_A 3fvx_B 4wlh_A 4wlh_B 4wlj_A 4wlj_B NP_001116143.1.87134 NP_001116143.1.92137 NP_004050.3.87134 NP_004050.3.92137 XP_011517470.1.92137 XP_011517471.1.92137 XP_011517472.1.92137 XP_016870754.1.92137 XP_016870755.1.92137 XP_016870756.1.92137 XP_016870757.1.92137 9606.ENSP00000302227 ENSP00000302227 ENSP00000302227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]