SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000304740 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000304740
Domain Number 1 Region: 59-138
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.42e-24
Family Cystathionine synthase-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000304740   Gene: ENSG00000244005   Transcript: ENST00000306750
Sequence length 189
Comment pep:putative chromosome:GRCh38:20:35694572:35699304:-1 gene:ENSG00000244005 transcript:ENST00000306750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRAAWRRAAVAVTAAPGPKPAAPTRGLRLRVGDRAPQSAVPADTAAAPEVGPVLRPLY
MDVQATTPLDPRVLDAMLPYLINYYGNPHSRTHAYGWESEAAMERARQQVASLIGADPRE
IIFTSGATESNNIAIKTESHSVIQAGVQWHDLDSLQAPPPGFTPFSCLSLLSSWDYRRPP
PHPANFLYF
Download sequence
Identical sequences Q8WV90
ENSP00000304740 ENSP00000304740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]