SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000308606 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000308606
Domain Number 1 Region: 38-136
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000577
Family Thioltransferase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000308606   Gene: ENSG00000173467   Transcript: ENST00000310398
Sequence length 166
Comment pep:known chromosome:GRCh38:7:16859405:16881987:-1 gene:ENSG00000173467 transcript:ENST00000310398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKK
PLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIM
FVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL
Download sequence
Identical sequences G1S3I0 Q8TD06
ENSNLEP00000020068 ENSP00000308606 9606.ENSP00000308606 ENSP00000308606 gi|28827801|ref|NP_789783.1| NYSGXRC-13006b ENSP00000308606 ENSNLEP00000020068 NP_789783.1.87134 NP_789783.1.92137 XP_003252658.1.23891 XP_005249684.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]