SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000317606 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000317606
Domain Number 1 Region: 6-321
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.13e-95
Family GABA-aminotransferase-like 0.000000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000317606   Gene: ENSG00000135069   Transcript: ENST00000347159
Sequence length 324
Comment pep:known chromosome:GRCh38:9:78297143:78329454:1 gene:ENSG00000135069 transcript:ENST00000347159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLV
RELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGT
INIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSN
FLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLY
NTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVSVGGIRASLY
NAVTIEDVQKLAAFMKKFLEMHQL
Download sequence
Identical sequences A0A024R280 G3SJS7 H2QXD6
gi|10863955|ref|NP_066977.1| ENSP00000317606 ENSP00000317606 NP_066977.1.87134 NP_066977.1.92137 XP_018889440.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]