SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000321290 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000321290
Domain Number 1 Region: 74-213
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.14e-29
Family GABA-aminotransferase-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000321290   Gene: ENSG00000175309   Transcript: ENST00000323594
Sequence length 219
Comment pep:novel chromosome:GRCh38:5:178224449:178232630:-1 gene:ENSG00000175309 transcript:ENST00000323594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADQRPKADTLALRQRLISHLFSGSGRLTRTHAEMSKEATEAENAFRNNPKFQRLVTPS
ASCFATTCGVERQVGHCHPLVVQAAHEQNQVLNTNSRYLHDNIVDYAQRLSETLPEQLCV
FYFLNSGSEANDLALRLARHYTGHQDVVVLDHAYHGHLSSLIDISPYKFRNLDGQKEWVH
VAPLPDTYRGPYREDHPNPAMAYANEVKRVVSSAQEKGR
Download sequence
Identical sequences H7BXR0
ENSP00000321290 ENSP00000321290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]