SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000323096 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000323096
Domain Number 1 Region: 31-238
Classification Level Classification E-value
Superfamily L domain-like 1.3e-34
Family Ngr ectodomain-like 0.0073
Further Details:      
 
Domain Number 2 Region: 285-389
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000326
Family I set domains 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000323096   Gene: ENSG00000176020   Transcript: ENST00000320431
Sequence length 504
Comment pep:known chromosome:GRCh38:3:49716834:49719695:-1 gene:ENSG00000176020 transcript:ENST00000320431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGLGLQDVPAELP
AATADLDLSHNALQRLRPGWLAPLFQLRALHLDHNELDALGRGVFVNASGLRLLDLSSNT
LRALGRHDLDGLGALEKLLLFNNRLVHLDEHAFHGLRALSHLYLGCNELASFSFDHLHGL
SATHLLTLDLSSNRLGHISVPELAALPAFLKNGLYLHNNPLPCDCRLYHLLQRWHQRGLS
AVRDFAREYVCLAFKVPASRVRFFQHSRVFENCSSAPALGLERPEEHLYALVGRSLRLYC
NTSVPAMRIAWVSPQQELLRAPGSRDGSIAVLADGSLAIGNVQEQHAGLFVCLATGPRLH
HNQTHEYNVSVHFPRPEPEAFNTGFTTLLGCAVGLVLVLLYLFAPPCRCCRRACRCRRWP
QTPSPLQELSAQSSVLSTTPPDAPSRKASVHKHVVFLEPGRRGLNGRVQLAVAEEFDLYN
PGGLQLKAGSESASSIGSEGPMTT
Download sequence
Identical sequences Q86WK7
ENSP00000323096 ENSP00000323096 ENSP00000439268 gi|38454322|ref|NP_942015.1| NYSGRC-IgSF-AMGO3_HUMAN 9606.ENSP00000323096 ENSP00000323096 NP_942015.1.87134 NP_942015.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]