SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000336808 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000336808
Domain Number 1 Region: 5-421
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.88e-148
Family SCOPe 0.0000000000545
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000336808   Gene: ENSG00000109576   Transcript: ENST00000337664
Sequence length 425
Comment pep:known chromosome:GRCh38:4:170060222:170089967:-1 gene:ENSG00000109576 transcript:ENST00000337664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKT
IQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQG
LCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKP
EDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQ
LMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV
KGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL
IKESL
Download sequence
Identical sequences Q4W5N8 Q8N5Z0
9606.ENSP00000226840 d2qlra_ d2qlrb_ d2qlrc_ d2qlrd_ d2r2na_ d2r2nb_ d2r2nc_ d2r2nd_ d3dc1a_ d3dc1b_ d3dc1c_ d3dc1d_ d5efsa_ d5euna_ d5tf5a_ d5tf5b_ gi|33469970|ref|NP_872603.1| gi|7705897|ref|NP_057312.1| NP_001273612.1.87134 NP_001273612.1.92137 NP_057312.1.87134 NP_057312.1.92137 NP_872603.1.87134 NP_872603.1.92137 ENSP00000226840 ENSP00000336808 ENSP00000423341 2qlr_A 2qlr_B 2qlr_C 2qlr_D 2r2n_A 2r2n_B 2r2n_C 2r2n_D 3dc1_A 3dc1_B 3dc1_C 3dc1_D 5efs_A 5eun_A 5tf5_A 5tf5_B ENSP00000226840 ENSP00000336808 ENSP00000423341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]