SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000337635 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000337635
Domain Number 1 Region: 56-142
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00000000000281
Family GABA-aminotransferase-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000337635   Gene: ENSG00000090054   Transcript: ENST00000337841
Sequence length 143
Comment pep:known chromosome:GRCh38:9:92079061:92115383:-1 gene:ENSG00000090054 transcript:ENST00000337841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEEL
IEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAA
ALASLKKYGVGTCGPRGFYGTFE
Download sequence
Identical sequences A0A2J8IXH0
ENSP00000337635 NP_847894.1.87134 NP_847894.1.92137 gi|30474871|ref|NP_847894.1| ENSP00000337635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]