SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000340129 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000340129
Domain Number 1 Region: 5-189
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.57e-42
Family Calponin-homology domain, CH-domain 0.0000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000340129   Gene: ENSG00000064666   Transcript: ENST00000348419
Sequence length 270
Comment pep:known chromosome:GRCh38:19:1026610:1039068:1 gene:ENSG00000064666 transcript:ENST00000348419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTIL
CTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQV
QVSLLALAGKMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQMGTNKCASQV
GMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTV
ADGAPSGTGDCPDPGEVPEYPPYYQEEAGY
Download sequence
Identical sequences A0A2J8J2C4 A0A2J8R9Y6
gi|41327730|ref|NP_958434.1| ENSP00000340129 ENSP00000340129 NP_958434.1.87134 NP_958434.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]