SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000342492 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000342492
Domain Number 1 Region: 9-206,252-362
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.87e-56
Family Calponin-homology domain, CH-domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000342492   Gene: ENSG00000188677   Transcript: ENST00000338758
Sequence length 364
Comment pep:known chromosome:GRCh38:22:44024277:44172949:1 gene:ENSG00000188677 transcript:ENST00000338758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAPRSPTPRPRRMKKDESFLGKLGGTLARKRRAREVSDLQEEGKNAINSPMSPALVDV
HPEDTQLEENEERTMIDPTSKEDPKFKELVKVLLDWINDVLVEERIIVKQLEEDLYDGQV
LQKLLEKLAGCKLNVAEVTQSEIGQKQKLQTVLEAVHDLLRPRGWALRWSVDSIHGKNLV
AILHLLVSLAMHFRAPIRLPEHVTVQVVVVRKREGLLHSSHISEELTTTTEMMMGRFERD
AFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEDYFV
PLHHFYLTPESFDQKVHNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKY
KNVE
Download sequence
Identical sequences Q9HBI1
gi|20127528|ref|NP_037459.2| NP_037459.2.87134 NP_037459.2.92137 ENSP00000342492 ENSP00000342492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]