SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000348017 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000348017
Domain Number 1 Region: 205-418
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-61
Family DBL homology domain (DH-domain) 0.0000000659
Further Details:      
 
Domain Number 2 Region: 403-559
Classification Level Classification E-value
Superfamily PH domain-like 2.04e-47
Family Pleckstrin-homology domain (PH domain) 0.00000222
Further Details:      
 
Domain Number 3 Region: 111-229
Classification Level Classification E-value
Superfamily SH3-domain 6.83e-23
Family SH3-domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000348017   Gene: ENSG00000136002   Transcript: ENST00000355771
Sequence length 619
Comment pep:known chromosome:GRCh38:2:131011683:131046189:1 gene:ENSG00000136002 transcript:ENST00000355771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPDGQQALDAVVRSFDCHSEAALRQRNDVIYCSLPRTAQGIVQREDQLEVLVSLREVWG
RRRGRDGTCTGAMPDGALDTAVCADEVGSEEDLYDDLHSSSHHYSHPGGGGEQLAINELI
SDGSVVCAEALWDHVTMDDQELGFKAGDVIEVMDATNREWWWGRVADGEGWFPASFVRLR
VNQDEPADDDAPLAGNSGAEDGGAEAQSSKDQMRTNVINEILSTERDYIKHLRDICEGYV
RQCRKRADMFSEEQLRTIFGNIEDIYRCQKAFVKALEQRFNRERPHLSELGACFLEHQAD
FQIYSEYCNNHPNACVELSRLTKLSKYVYFFEACRLLQKMIDISLDGFLLTPVQKICKYP
LQLAELLKYTHPQHRDFKDVEAALHAMKNVAQLINERKRRLENIDKIAQWQSSIEDWEGE
DLLVRSSELIYSGELTRVTQPQAKSQQRMFFLFDHQLIYCKKDLLRRDVLYYKGRLDMDG
LEVVDLEDGKDRDLHVSIKNAFRLHRGATGDSHLLCTRKPEQKQRWLKAFAREREQVQLD
QETGFSITELQRKQAMLNASKQQVTGKPKAVGRPCYLTRQKHPALPSNRPQQQVLVLAEP
RRKPSTFWHSISRLAPFRK
Download sequence
Identical sequences ENSP00000348017 ENSP00000348017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]