SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000350153 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000350153
Domain Number 1 Region: 197-317
Classification Level Classification E-value
Superfamily EF-hand 9.22e-37
Family Osteonectin 0.01
Further Details:      
 
Domain Number 2 Region: 286-379
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 8.37e-29
Family Thyroglobulin type-1 domain 0.00078
Further Details:      
 
Domain Number 3 Region: 126-180
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000457
Family Ovomucoid domain III-like 0.0079
Further Details:      
 
Weak hits

Sequence:  ENSP00000350153
Domain Number - Region: 392-430
Classification Level Classification E-value
Superfamily ARM repeat 0.0317
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000350153   Gene: ENSG00000196104   Transcript: ENST00000357545
Sequence length 433
Comment pep:known chromosome:GRCh38:4:166733387:167234549:-1 gene:ENSG00000196104 transcript:ENST00000357545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKVSAVLCVCAAAWCSQSLAAAAAVAAAGGRSDGGNFLDDKQWLTTISQYDKEVGQWNK
FRDDDYFRTWSPGKPFDQALDPAKDPCLKMKCSRHKVCIAQDSQTAVCISHRRLTHRMKE
AGVDHRQWRGPILSTCKQCPVVYPSPVCGSDGHTYSFQCKLEYQACVLGKQISVKCEGHC
PCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKTLLRPERSRFDT
SILPICKDSLGWMFNRLDTNYDLLLDQSELRSIYLDKNEQCTKAFFNSCDTYKDSLISNN
EWCYCFQRQQDPPCQTELSNIQKRQGVKKLLGQYIPLCDEDGYYKPTQCHGSVGQCWCVD
RYGNEVMGSRINGVADCAIDFEISGDFASGDFHEWTDDEDDEDDIMNDEDEIEDDDEDEG
DDDDGGDDHDVYI
Download sequence
Identical sequences gi|93141003|ref|NP_001035249.1| ENSP00000350153 ENSP00000425502 ENSP00000425570 9606.ENSP00000350153 ENSP00000350153 ENSP00000425502 ENSP00000425570 NP_001035249.1.87134 NP_001035249.1.92137 XP_016863747.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]