SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000355808 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000355808
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily PH domain-like 2.24e-44
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000144
Further Details:      
 
Domain Number 2 Region: 530-568
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.00000000000288
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000355808   Gene: ENSG00000154380   Transcript: ENST00000366843
Sequence length 570
Comment pep:known chromosome:GRCh38:1:225497085:225653045:-1 gene:ENSG00000154380 transcript:ENST00000366843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVI
NCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQETGPTL
PRQNSQLPAQVQNGPSQEELEIQRRQLQEQQRQKELERERLERERMERERLERERLERER
LERERLEQEQLERERQERERQERLERQERLERQERLERQERLDRERQERQERERLERLER
ERQERERQEQLEREQLEWERERRISSAAAPASVETPLNSVLGDSSASEPGLQAASQPAET
PSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQV
PPPPPPPPAPPLPASGFFLASMSEDNRPLTGLAAAIAGAKLRKVSRMEDTSFPSGGNAIG
VNSASSKTDTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDKGEDSEPV
TSKASSTSTPEPTRKPWERTNTMNGSKSPVISRPKSTPLSQPSANGVQTEGLDYDRLKQD
ILDEMRKELTKLKEELIDAIRQELSKSNTA
Download sequence
Identical sequences NP_060682.2.87134 NP_060682.2.92137 ENSP00000355808 ENSP00000355808 gi|39930375|ref|NP_060682.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]