SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000358450 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358450
Domain Number 1 Region: 44-252
Classification Level Classification E-value
Superfamily Macro domain-like 5.1e-50
Family Macro domain 0.0002
Further Details:      
 
Domain Number 2 Region: 329-470
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000000000209
Family CRAL/TRIO domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358450   Gene: ENSG00000196505   Transcript: ENST00000369442
Sequence length 496
Comment pep:known chromosome:GRCh38:1:117877222:117929583:-1 gene:ENSG00000196505 transcript:ENST00000369442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLGAPSQFVDVDTLPSWGDSCQDELNSSDTTAEIFQEDTVRSPFLYNKDVNGKVVLWK
GDVALLNCTAIVNTSNESLTDKNPVSESIFMLAGPDLKEDLQKLKGCRTGEAKLTKGFNL
AARFIIHTVGPKYKSRYRTAAESSLYSCYRNVLQLAKEQSMSSVGFCVINSAKRGYPLED
ATHIALRTVRRFLEIHGETIEKVVFAVSDLEEGTYQKLLPLYFPRSLKEENRSLPYLPAD
IGNAEGEPVVPERQIRISEKPGAPEDNQEEEDEGLGVDLSFIGSHAFARMEGDIDKQRKL
ILQGQLSEAALQKQHQRNYNRWLCQARSEDLSDIASLKALYQTGVDNCGRTVMVVVGRNI
PVTLIDMDKALLYFIHVMDHIAVKEYVLVYFHTLTSEYNHLDSDFLKKLYDVVDVKYKRN
LKAVYFVHPTFRSKVSTWFFTTFSVSGLKDKIHHVDSLHQLFSAISPEQIDFPPFVLEYD
ARVRSTRSSPSPGMVY
Download sequence
Identical sequences ENSP00000358450 gi|207450721|ref|NP_001129061.1| 399796 NP_001129061.1.87134 NP_001129061.1.92137 ENSP00000358450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]