SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000358451 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000358451
Domain Number 1 Region: 44-252
Classification Level Classification E-value
Superfamily Macro domain-like 5.1e-50
Family Macro domain 0.0002
Further Details:      
 
Domain Number 2 Region: 329-470
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000000000144
Family CRAL/TRIO domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000358451   Gene: ENSG00000196505   Transcript: ENST00000369443
Sequence length 497
Comment pep:known chromosome:GRCh38:1:117863485:117929630:-1 gene:ENSG00000196505 transcript:ENST00000369443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLGAPSQFVDVDTLPSWGDSCQDELNSSDTTAEIFQEDTVRSPFLYNKDVNGKVVLWK
GDVALLNCTAIVNTSNESLTDKNPVSESIFMLAGPDLKEDLQKLKGCRTGEAKLTKGFNL
AARFIIHTVGPKYKSRYRTAAESSLYSCYRNVLQLAKEQSMSSVGFCVINSAKRGYPLED
ATHIALRTVRRFLEIHGETIEKVVFAVSDLEEGTYQKLLPLYFPRSLKEENRSLPYLPAD
IGNAEGEPVVPERQIRISEKPGAPEDNQEEEDEGLGVDLSFIGSHAFARMEGDIDKQRKL
ILQGQLSEAALQKQHQRNYNRWLCQARSEDLSDIASLKALYQTGVDNCGRTVMVVVGRNI
PVTLIDMDKALLYFIHVMDHIAVKEYVLVYFHTLTSEYNHLDSDFLKKLYDVVDVKYKRN
LKAVYFVHPTFRSKVSTWFFTTFSVSGLKDKIHHVDSLHQLFSAISPEQIDFPPFVLEYD
ARENGPYYTSYPPSPDL
Download sequence
Identical sequences Q9NXN4
9606.ENSP00000358451 NP_060156.1.87134 NP_060156.1.92137 gi|8923143|ref|NP_060156.1| ENSP00000358451 ENSP00000358450 ENSP00000358451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]