SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000359225 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359225
Domain Number 1 Region: 3-186
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.32e-48
Family Calponin-homology domain, CH-domain 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359225   Gene: ENSG00000117519   Transcript: ENST00000370206
Sequence length 329
Comment pep:known chromosome:GRCh38:1:94896951:94927278:-1 gene:ENSG00000117519 transcript:ENST00000370206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCE
LINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQT
TLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMT
AYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDN
STISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDY
QAEYPDEYHGEYQDDYPRDYQYSDQGIDY
Download sequence
Identical sequences Q15417
ENSP00000359225 ENSP00000437665 9606.ENSP00000359225 NP_001830.1.87134 NP_001830.1.92137 gi|4502923|ref|NP_001830.1| ENSP00000359225 ENSP00000359225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]