SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000359517 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359517
Domain Number 1 Region: 40-260
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.31e-61
Family AAT-like 0.00000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359517   Gene: ENSG00000137944   Transcript: ENST00000370486
Sequence length 262
Comment pep:putative chromosome:GRCh38:1:88961167:88992953:-1 gene:ENSG00000137944 transcript:ENST00000370486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLA
ADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQK
QIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRS
KPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYD
TLCISDEVYEWLVYSGNKHLKI
Download sequence
Identical sequences A0A0A0MRN7
ENSP00000359517 ENSP00000359517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]