SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000359522 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359522
Domain Number 1 Region: 6-415
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.31e-99
Family AAT-like 0.00000000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359522   Gene: ENSG00000137944   Transcript: ENST00000370491
Sequence length 420
Comment pep:known chromosome:GRCh38:1:88935773:88992776:-1 gene:ENSG00000137944 transcript:ENST00000370491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKFTNAKRIEGLDSNVWIEFTKLAADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSL
NQYTRGFGHPSLVKALSYLYEKLYQKQIDSNKEILVTVGAYGSLFNTIQALIDEGDEVIL
IVPFYDCYEPMVRMAGATPVFIPLRSKPVYGKRWSSSDWTLDPQELESKFNSKTKAIILN
TPHNPLGKVYNREELQVIADLCIKYDTLCISDEVYEWLVYSGNKHLKIATFPGMWERTIT
IGSAGKTFSVTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDD
PECYFNSLPKELEVKRDRMVRLLESVGLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYD
YKFVKWMTKHKKLSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS
Download sequence
Identical sequences NP_001008662.1.87134 NP_001008662.1.92137 gi|56713256|ref|NP_001008662.1| ENSP00000359522 ENSP00000359522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]