SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000359539 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000359539
Domain Number 1 Region: 4-412
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.8e-124
Family AAT-like 0.000000000000621
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000359539   Gene: ENSG00000120053   Transcript: ENST00000370508
Sequence length 413
Comment pep:known chromosome:GRCh38:10:99396870:99430593:-1 gene:ENSG00000120053 transcript:ENST00000370508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQK
IANDNSLNHEYLPILGLAEFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFL
ARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLEN
APEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWA
IRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPP
AQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGM
FSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ
Download sequence
Identical sequences A0A140VK69 G3QJC1 H2Q2E4 P17174
ENSGGOP00000002510 ENSP00000359539 W00106 W00292 gi|4504067|ref|NP_002070.1| 9598.ENSPTRP00000004968 9606.ENSP00000359539 ENSP00000359539 ENSPTRP00000004968 ENSGGOP00000002510 NP_002070.1.87134 NP_002070.1.92137 XP_003825503.1.60992 XP_004049976.1.27298 ENSPTRP00000004968 ENSP00000359539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]