SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000365424 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000365424
Domain Number 1 Region: 3-128
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.8e-23
Family Pyridoxal-dependent decarboxylase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000365424   Gene: ENSG00000136750   Transcript: ENST00000376248
Sequence length 129
Comment pep:known chromosome:GRCh38:10:26218193:26224760:1 gene:ENSG00000136750 transcript:ENST00000376248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNILLQYVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTG
HPRYFNQLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGS
GDGIFSPGT
Download sequence
Identical sequences A0A2J8MNL0 A0A2J8SUR0 A0A2K5YHP4 A0A2K6NS18 Q5VZ29
ENSP00000365424 ENSP00000365424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]