SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000365437 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000365437
Domain Number 1 Region: 110-584
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.05e-137
Family Pyridoxal-dependent decarboxylase 0.0000853
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000365437   Gene: ENSG00000136750   Transcript: ENST00000376261
Sequence length 585
Comment pep:known chromosome:GRCh38:10:26216307:26304558:1 gene:ENSG00000136750 transcript:ENST00000376261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPGSGFWSFGSEDGSGDSENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG
SQPPRAAARKAACACDQKPCSCSKVDVNYAFLHATDLLPACDGERPTLAFLQDVMNILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMMIARFKMFPEVKEKGMAALPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEY
LYNIIKNREGYEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEY
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
Download sequence
Identical sequences Q05329 Q5VZ30
9606.ENSP00000259271 NP_000809.1.87134 NP_000809.1.92137 NP_001127838.1.87134 NP_001127838.1.92137 gi|197276620|ref|NP_001127838.1| gi|4503875|ref|NP_000809.1| ENSP00000259271 ENSP00000365437 ENSP00000259271 ENSP00000259271 ENSP00000365437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]