SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000366969 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000366969
Domain Number 1 Region: 403-625
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-52
Family DBL homology domain (DH-domain) 0.0000885
Further Details:      
 
Domain Number 2 Region: 629-762
Classification Level Classification E-value
Superfamily PH domain-like 7.12e-27
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 3 Region: 151-227
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000909
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000366969   Gene: ENSG00000171680   Transcript: ENST00000377740
Sequence length 852
Comment pep:known chromosome:GRCh38:1:6467122:6520061:-1 gene:ENSG00000171680 transcript:ENST00000377740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSVLTKHGSPPRSWLSLCSGTDDQSPAEKKGLRCQNPACMDKGRAAKVCHHADCQQLHR
RGPLNLCEACDSKFHSTMHYDGHVRFDLPPQGSVLARNVSTRSCPPRTSPAVDLEEEEEE
SSVDGKGDRKSTGLKLSKKKARRRHTDDPSKECFTLKFDLNVDIETEIVPAMKKKSLGEV
LLPVFERKGIALGKVDIYLDQSNTPLSLTFEAYRFGGHYLRVKAPAKPGDEGKVEQGMKD
SKSLSLPILRPAGTGPPALERVDAQSRRESLDILAPGRRRKNMSEFLGEASIPGQEPPTP
SSCSLPSGSSGSTNTGDSWKNRAASRFSGFFSSGPSTSAFGREVDKMEQLEGKLHTYSLF
GLPRLPRGLRFDHDSWEEEYDEDEDEDNACLRLEDSWRELIDGHEKLTRRQCHQQEAVWE
LLHTEASYIRKLRVIINLFLCCLLNLQESGLLCEVEAERLFSNIPEIAQLHRRLWASVMA
PVLEKARRTRALLQPGDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYI
TWAEKHPQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTEEPRAKEAVVAMIGSVERFIH
HVNACMRQRQERQRLAAVVSRIDAYEVVESSSDEVDKLLKEFLHLDLTAPIPGASPEETR
QLLLEGSLRMKEGKDSKMDVYCFLFTDLLLVTKAVKKAERTRVIRPPLLVDKIVCRELRD
PGSFLLIYLNEFHSAVGAYTFQASGQALCRGWVDTIYNAQNQLQQLRAQEPPGSQQPLQS
LEEEEDEQEEEEEEEEEEEEGEDSGTSAASSPTIMRKSSGSPDSQHWKLTLAQLYRIRTT
LLLNSTLTASEV
Download sequence
Identical sequences Q5SY18
ENSP00000366969 ENSP00000366969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]