SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000368727 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000368727
Domain Number 1 Region: 694-1314
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 3e-208
Family Molybdenum cofactor-binding domain 3.93e-16
Further Details:      
 
Domain Number 2 Region: 194-412
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 7.32e-68
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.00000000707
Further Details:      
 
Domain Number 3 Region: 97-164
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 2.49e-47
Family CO dehydrogenase ISP C-domain like 0.00067
Further Details:      
 
Domain Number 4 Region: 553-695
Classification Level Classification E-value
Superfamily CO dehydrogenase molybdoprotein N-domain-like 5.27e-45
Family CO dehydrogenase molybdoprotein N-domain-like 0.000000266
Further Details:      
 
Domain Number 5 Region: 8-92
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.46e-40
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00011
Further Details:      
 
Domain Number 6 Region: 416-529
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 1.9e-34
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.00000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000368727   Gene: ENSG00000158125   Transcript: ENST00000379416
Sequence length 1333
Comment pep:known chromosome:GRCh38:2:31334321:31414715:-1 gene:ENSG00000158125 transcript:ENST00000379416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTADKLVFFVNGRKVVEKNADPETTLLAYLRRKLGLSGTKLGCGEGGCGACTVMLSKYDR
LQNKIVHFSANACLAPICSLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGI
VMSMYTLLRNQPEPTMEEIENAFQGNLCRCTGYRPILQGFRTFARDGGCCGGDGNNPNCC
MNQKKDHSVSLSPSLFKPEEFTPLDPTQEPIFPPELLRLKDTPRKQLRFEGERVTWIQAS
TLKELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPMIVCPAWIPELNSVEHGPDGISFG
AACPLSIVEKTLVDAVAKLPAQKTEVFRGVLEQLRWFAGKQVKSVASVGGNIITASPISD
LNPVFMASGAKLTLVSRGTRRTVQMDHTFFPGYRKTLLSPEEILLSIEIPYSREGEYFSA
FKQASRREDDIAKVTSGMRVLFKPGTTEVQELALCYGGMANRTISALKTTQRQLSKLWKE
ELLQDVCAGLAEELHLPPDAPGGMVDFRCTLTLSFFFKFYLTVLQKLGQENLEDKCGKLD
PTFASATLLFQKDPPADVQLFQEVPKGQSEEDMVGRPLPHLAADMQASGEAVYCDDIPRY
ENELSLRLVTSTRAHAKIKSIDTSEAKKVPGFVCFISADDVPGSNITGICNDETVFAKDK
VTCVGHIIGAVVADTPEHTQRAAQGVKITYEELPAIITIEDAIKNNSFYGPELKIEKGDL
KKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVPKGEAGEMELFVSTQNTMKTQSFVAKM
LGVPANRIVVRVKRMGGGFGGKETRSTVVSTAVALAAYKTGRPVRCMLDRDEDMLITGGR
HPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMERALFHMDNCYKIPNIRGTGR
LCKTNLPSNTAFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRKNLYKEGDLTHFNQKL
EGFTLPRCWEECLASSQYHARKSEVDKFNKENCWKKRGLCIIPTKFGISFTVPFLNQAGA
LLHVYTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISETSTNTVPNTSPTAA
SVSADLNGQAVYAACQTILKRLEPYKKKNPSGSWEDWVTAAYMDTVSLSATGFYRTPNLG
YSFETNSGNPFHYFSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAF
VQGLGLFTLEELHYSPEGSLHTRGPSTYKIPAFGSIPIEFRVSLLRDCPNKKAIYASKAV
GEPPLFLAASIFFAIKDAIRAARAQHTGNNVKELFRLDSPATPEKIRNACVDKFTTLCVT
GVPENCKPWSVRV
Download sequence
Identical sequences P47989
ENSP00000368727 2ckj_A 2ckj_B 2ckj_C 2ckj_D 9606.ENSP00000368727 NP_000370.2.87134 NP_000370.2.92137 ENSP00000368727 ENSP00000368727 gi|91823271|ref|NP_000370.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]