SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000369172 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000369172
Domain Number 1 Region: 37-188
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.94e-32
Family GABA-aminotransferase-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000369172   Gene: ENSG00000139631   Transcript: ENST00000379843
Sequence length 267
Comment pep:known chromosome:GRCh38:12:53157689:53173775:-1 gene:ENSG00000139631 transcript:ENST00000379843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSEALPSLAGDPVAVEALLRAVFGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLEL
RSQGESQKQILERCRAVIRYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEI
APVFVLMEEEVLRKLRALVGWSSGDGIFCPGGSISNMYAVNLARYQRYPDCKQRGLRTLP
PLALFTSKEVGKRHRPNPGLLILISSHVTTPSRRELRFWDLAPTVSEWSRLMREGKWSPR
IWRGRLVWPRLRVLCRSWSVPPLAPLC
Download sequence
Identical sequences Q9Y602
ENSP00000369172 ENSP00000436800 ENSP00000436800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]