SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000369179 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000369179
Domain Number 1 Region: 63-518
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.88e-127
Family Pyridoxal-dependent decarboxylase 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000369179   Gene: ENSG00000139631   Transcript: ENST00000379850
Sequence length 519
Comment pep:novel chromosome:GRCh38:12:53157690:53180596:-1 gene:ENSG00000139631 transcript:ENST00000379850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLGDARRGAAGYLCTLPPALLSREILMADSEALPSLAGDPVAVEALLRAVFGVVVDEAIQ
KGTSVSQKVCEWKEPEELKQLLDLELRSQGESQKQILERCRAVIRYSVKTGHPRFFNQLF
SGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLRKLRALVGWSSGDGIFCPGGSI
SNMYAVNLARYQRYPDCKQRGLRTLPPLALFTSKECHYSIQKGAAFLGLGTDSVRVVKAD
ERGKMVPEDLERQIGMAEAEGAVPFLVSATSGTTVLGAFDPLEAIADVCQRHGLWLHVDA
AWGGSVLLSQTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLQDTSNLLKRCHGSQAS
YLFQQDKFYDVALDTGDKVVQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEE
MKKREGFELVMEPEFVNVCFWFVPPSLRGKQESPDYHERLSKVAPVLKERMVKEGSMMIG
YQPHGTRGNFFRVVVANSALTCADMDFLLNELERLGQDL
Download sequence
Identical sequences J3KPG9
ENSP00000369179 ENSP00000369179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]