SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000371110 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000371110
Domain Number 1 Region: 91-438
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.03e-107
Family GABA-aminotransferase-like 0.00000000641
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000371110   Gene: ENSG00000100116   Transcript: ENST00000323205
Sequence length 445
Comment pep:novel chromosome:GRCh38:22:37807905:37817176:1 gene:ENSG00000100116 transcript:ENST00000323205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPGNAWRAALFWVPRGRRAQSALAQLRGILEGELEGIRGAGTWKSERVITSRQGPHIRV
DGVSGGPGTVIFPGLPLPHLSCCIHLLSFTSGILNFCANNYLGLSSHPEVIQAGLQALEE
FGAGLSSVRFICGTQSIHKNLEAKIARFHQREDAILYPSCYDANAGLFEALLTPEDAVLS
DELNHASIIDGIRLCKAHKYRYRHLDMADLEAKLQEAQKHRLRLVATDGAFSMDGDIAPL
QEICCLASRYGALVFMDECHATGFLGPTGRGTDELLGVMDQVTIINSTLGKALGGASGGY
TTGPGPLVSLLRQRARPYLFSNSLPPAVVGCASKALDLLMGSNTIVQSMAAKTQRFRSKM
EAAGFTISGASHPICPVMLGDARLASRMADDMLKRGIFVIGFSYPVVPKGKARIRVQISA
VHSEEDIDRCVEAFVEVGRLHGALP
Download sequence
Identical sequences gi|284448556|ref|NP_001165161.1| ENSP00000248924 ENSP00000371110 NP_001165161.1.87134 NP_001165161.1.92137 XP_005261467.1.92137 ENSP00000371110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]